GLP Cagrilintide Amylin Analog (5mg)-The Next-Gen Amylin Analog Guide
GLP C is a novel long-acting amylin analogue featuring N-terminal lipidation that extends its half-life by binding to albumin.
Key Features
- Lab-tested >99% purity
- Independent HPLC verification
- USA synthesized
- Cold-chain shipping
Premium research compound manufactured in the USA. Strictly for laboratory research and development purposes. Not for human or animal consumption.
Certificate of Analysis
Batch #VOX-0217 tested May 2026.
- Purity: >99.6%
- Mass Spectrometry: Passed
>99.6% Purity
Verified by independent labs
USA Made
Synthesized in domestic facilities
About This Product
GLP C Description
GLP C is a novel long-acting amylin analogue featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems.
Peptide Information
| Property | Value |
|---|---|
| Peptide Sequence | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Molecular Formula | C194H312N54O59S2 |
| Molecular Weight | 4409 g/mol |
| CAS Number | 1415456-99-3 |
| PubChem CID | 171397054 |
| Synonyms | 1415456-99-3, Cagrilintide [INN], AO43BIF1U8, LDERDVMBIYGIOI-IZVMHKDJSA-N |
GLP C Peptide Structure
Lyophilized Peptides:
Our GLP C is provided as a lyophilized (freeze-dried) powder. This process extends shelf life and preserves the purity and integrity of the peptide without the use of any fillers.
Product Usage:
This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug.
Scientific Reviewer
Scientifically reviewed by Dr. Ky H. Le, MD. Dr. Le is a board-certified family medicine physician with over 20 years of clinical experience. Dr. Le validates the scientific accuracy of all technical content and research citations.
Disclaimer: For Research Purposes Only
Customer Reviews
Be the first to review
Reviews
There are no reviews yet.